TNFRSF10A polyclonal antibody (A02)
  • TNFRSF10A polyclonal antibody (A02)

TNFRSF10A polyclonal antibody (A02)

Ref: AB-H00008797-A02
TNFRSF10A polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNFRSF10A.
Información adicional
Size 50 uL
Gene Name TNFRSF10A
Gene Alias APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1
Gene Description tumor necrosis factor receptor superfamily, member 10a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFRSF10A (AAH12866, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8797

Enviar un mensaje


TNFRSF10A polyclonal antibody (A02)

TNFRSF10A polyclonal antibody (A02)