SCEL monoclonal antibody (M01), clone 4B12
  • SCEL monoclonal antibody (M01), clone 4B12

SCEL monoclonal antibody (M01), clone 4B12

Ref: AB-H00008796-M01
SCEL monoclonal antibody (M01), clone 4B12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCEL.
Información adicional
Size 100 ug
Gene Name SCEL
Gene Alias FLJ21667|MGC22531
Gene Description sciellin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYSSDDTLDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCEL (NP_003834.2, 2 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8796
Clone Number 4B12
Iso type IgG2b Kappa

Enviar un mensaje


SCEL monoclonal antibody (M01), clone 4B12

SCEL monoclonal antibody (M01), clone 4B12