RGS11 MaxPab mouse polyclonal antibody (B01P)
  • RGS11 MaxPab mouse polyclonal antibody (B01P)

RGS11 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008786-B01P
RGS11 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RGS11 protein.
Información adicional
Size 50 ug
Gene Name RGS11
Gene Alias RS11
Gene Description regulator of G-protein signaling 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RGS11 (AAI53020.1, 1 a.a. ~ 467 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8786

Enviar un mensaje


RGS11 MaxPab mouse polyclonal antibody (B01P)

RGS11 MaxPab mouse polyclonal antibody (B01P)