CDS2 polyclonal antibody (A01)
  • CDS2 polyclonal antibody (A01)

CDS2 polyclonal antibody (A01)

Ref: AB-H00008760-A01
CDS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDS2.
Información adicional
Size 50 uL
Gene Name CDS2
Gene Alias FLJ38111
Gene Description CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDS2 (NP_003809, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8760

Enviar un mensaje


CDS2 polyclonal antibody (A01)

CDS2 polyclonal antibody (A01)