ADAM20 polyclonal antibody (A01)
  • ADAM20 polyclonal antibody (A01)

ADAM20 polyclonal antibody (A01)

Ref: AB-H00008748-A01
ADAM20 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ADAM20.
Información adicional
Size 50 uL
Gene Name ADAM20
Gene Alias -
Gene Description ADAM metallopeptidase domain 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ADAM20 (NP_003805, 268 a.a. ~ 358 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8748

Enviar un mensaje


ADAM20 polyclonal antibody (A01)

ADAM20 polyclonal antibody (A01)