TNFSF14 monoclonal antibody (M01A), clone 4E3
  • TNFSF14 monoclonal antibody (M01A), clone 4E3

TNFSF14 monoclonal antibody (M01A), clone 4E3

Ref: AB-H00008740-M01A
TNFSF14 monoclonal antibody (M01A), clone 4E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TNFSF14.
Información adicional
Size 200 uL
Gene Name TNFSF14
Gene Alias CD258|HVEML|LIGHT|LTg|TR2
Gene Description tumor necrosis factor (ligand) superfamily, member 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGVAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFSF14 (AAH18058, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 8740
Clone Number 4E3
Iso type IgG2a Kappa

Enviar un mensaje


TNFSF14 monoclonal antibody (M01A), clone 4E3

TNFSF14 monoclonal antibody (M01A), clone 4E3