TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)
  • TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)

TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00008740-B02P
TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TNFSF14 protein.
Información adicional
Size 50 ug
Gene Name TNFSF14
Gene Alias CD258|HVEML|LIGHT|LTg|TR2
Gene Description tumor necrosis factor (ligand) superfamily, member 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFSF14 (NP_742011.1, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8740

Enviar un mensaje


TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)

TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)