CTNNAL1 monoclonal antibody (M01), clone 1H5
  • CTNNAL1 monoclonal antibody (M01), clone 1H5

CTNNAL1 monoclonal antibody (M01), clone 1H5

Ref: AB-H00008727-M01
CTNNAL1 monoclonal antibody (M01), clone 1H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CTNNAL1.
Información adicional
Size 100 ug
Gene Name CTNNAL1
Gene Alias CLLP|FLJ08121|alpha-CATU
Gene Description catenin (cadherin-associated protein), alpha-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TDCKPNGETDISSISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTNNAL1 (NP_003789, 277 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8727
Clone Number 1H5
Iso type IgG2b Kappa

Enviar un mensaje


CTNNAL1 monoclonal antibody (M01), clone 1H5

CTNNAL1 monoclonal antibody (M01), clone 1H5