CTNNAL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CTNNAL1 purified MaxPab rabbit polyclonal antibody (D01P)

CTNNAL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008727-D01P
CTNNAL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTNNAL1 protein.
Información adicional
Size 100 ug
Gene Name CTNNAL1
Gene Alias CLLP|FLJ08121|alpha-CATU
Gene Description catenin (cadherin-associated protein), alpha-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKKSDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDITNLNHLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMERLEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLTASKTCLRHPNCESAH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTNNAL1 (NP_003789.1, 1 a.a. ~ 734 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8727

Enviar un mensaje


CTNNAL1 purified MaxPab rabbit polyclonal antibody (D01P)

CTNNAL1 purified MaxPab rabbit polyclonal antibody (D01P)