C19orf2 polyclonal antibody (A01)
  • C19orf2 polyclonal antibody (A01)

C19orf2 polyclonal antibody (A01)

Ref: AB-H00008725-A01
C19orf2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C19orf2.
Información adicional
Size 50 uL
Gene Name C19orf2
Gene Alias FLJ10575|NNX3|RMP|URI
Gene Description chromosome 19 open reading frame 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C19orf2 (NP_003787, 371 a.a. ~ 475 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8725

Enviar un mensaje


C19orf2 polyclonal antibody (A01)

C19orf2 polyclonal antibody (A01)