SNX4 monoclonal antibody (M01), clone 4H8
  • SNX4 monoclonal antibody (M01), clone 4H8

SNX4 monoclonal antibody (M01), clone 4H8

Ref: AB-H00008723-M01
SNX4 monoclonal antibody (M01), clone 4H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNX4.
Información adicional
Size 100 ug
Gene Name SNX4
Gene Alias -
Gene Description sorting nexin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKECFSKM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNX4 (AAH18762, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8723
Clone Number 4H8
Iso type IgG2a Kappa

Enviar un mensaje


SNX4 monoclonal antibody (M01), clone 4H8

SNX4 monoclonal antibody (M01), clone 4H8