SNX4 purified MaxPab rabbit polyclonal antibody (D01P)
  • SNX4 purified MaxPab rabbit polyclonal antibody (D01P)

SNX4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008723-D01P
SNX4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNX4 protein.
Información adicional
Size 100 ug
Gene Name SNX4
Gene Alias -
Gene Description sorting nexin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEISVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVYYPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLFLTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQSVISHLLRVRARVADRLYGVYKVH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNX4 (NP_003785.1, 1 a.a. ~ 450 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8723

Enviar un mensaje


SNX4 purified MaxPab rabbit polyclonal antibody (D01P)

SNX4 purified MaxPab rabbit polyclonal antibody (D01P)