EDF1 monoclonal antibody (M03), clone 3E6
  • EDF1 monoclonal antibody (M03), clone 3E6

EDF1 monoclonal antibody (M03), clone 3E6

Ref: AB-H00008721-M03
EDF1 monoclonal antibody (M03), clone 3E6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EDF1.
Información adicional
Size 100 ug
Gene Name EDF1
Gene Alias EDF-1|MBF1|MGC9058
Gene Description endothelial differentiation-related factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQSRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDF1 (AAH15500.1, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8721
Clone Number 3E6
Iso type IgG2a Kappa

Enviar un mensaje


EDF1 monoclonal antibody (M03), clone 3E6

EDF1 monoclonal antibody (M03), clone 3E6