EDF1 MaxPab mouse polyclonal antibody (B02)
  • EDF1 MaxPab mouse polyclonal antibody (B02)

EDF1 MaxPab mouse polyclonal antibody (B02)

Ref: AB-H00008721-B02
EDF1 MaxPab mouse polyclonal antibody (B02)

Información del producto

Mouse polyclonal antibody raised against a full-length human EDF1 protein.
Información adicional
Size 50 uL
Gene Name EDF1
Gene Alias EDF-1|MBF1|MGC9058
Gene Description endothelial differentiation-related factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EDF1 (NP_003783.1, 1 a.a. ~ 148 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8721

Enviar un mensaje


EDF1 MaxPab mouse polyclonal antibody (B02)

EDF1 MaxPab mouse polyclonal antibody (B02)