SERPINB7 purified MaxPab mouse polyclonal antibody (B01P)
  • SERPINB7 purified MaxPab mouse polyclonal antibody (B01P)

SERPINB7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008710-B01P
SERPINB7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SERPINB7 protein.
Información adicional
Size 50 ug
Gene Name SERPINB7
Gene Alias DKFZp686D06190|MEGSIN|MGC120014|MGC120015
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASLAAANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVLLPENDLSEIENKLTF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINB7 (NP_003775.1, 1 a.a. ~ 380 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8710

Enviar un mensaje


SERPINB7 purified MaxPab mouse polyclonal antibody (B01P)

SERPINB7 purified MaxPab mouse polyclonal antibody (B01P)