B4GALT2 purified MaxPab mouse polyclonal antibody (B01P)
  • B4GALT2 purified MaxPab mouse polyclonal antibody (B01P)

B4GALT2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008704-B01P
B4GALT2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human B4GALT2 protein.
Información adicional
Size 50 ug
Gene Name B4GALT2
Gene Alias B4Gal-T2|B4Gal-T3|beta4Gal-T2
Gene Description UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSTQLLAAAAAAATAPGPTPPPLAPGSLRSPVPCPVPRLPRCHPVLTRHLVLRVHRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKVSRPDIRIGRYRMIKHDRDKHNEPNP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen B4GALT2 (AAH02431, 1 a.a. ~ 306 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8704

Enviar un mensaje


B4GALT2 purified MaxPab mouse polyclonal antibody (B01P)

B4GALT2 purified MaxPab mouse polyclonal antibody (B01P)