B4GALT4 MaxPab mouse polyclonal antibody (B01)
  • B4GALT4 MaxPab mouse polyclonal antibody (B01)

B4GALT4 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00008702-B01
B4GALT4 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human B4GALT4 protein.
Información adicional
Size 50 uL
Gene Name B4GALT4
Gene Alias B4Gal-T4|beta4Gal-T4
Gene Description UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen B4GALT4 (AAH04523.1, 1 a.a. ~ 344 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8702

Enviar un mensaje


B4GALT4 MaxPab mouse polyclonal antibody (B01)

B4GALT4 MaxPab mouse polyclonal antibody (B01)