B4GALT4 polyclonal antibody (A01)
  • B4GALT4 polyclonal antibody (A01)

B4GALT4 polyclonal antibody (A01)

Ref: AB-H00008702-A01
B4GALT4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant B4GALT4.
Información adicional
Size 50 uL
Gene Name B4GALT4
Gene Alias B4Gal-T4|beta4Gal-T4
Gene Description UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNRE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen B4GALT4 (NP_003769, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8702

Enviar un mensaje


B4GALT4 polyclonal antibody (A01)

B4GALT4 polyclonal antibody (A01)