STX11 monoclonal antibody (M01), clone 4F9
  • STX11 monoclonal antibody (M01), clone 4F9

STX11 monoclonal antibody (M01), clone 4F9

Ref: AB-H00008676-M01
STX11 monoclonal antibody (M01), clone 4F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STX11.
Información adicional
Size 100 ug
Gene Name STX11
Gene Alias FHL4|HLH4|HPLH4
Gene Description syntaxin 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq LSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVADVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STX11 (NP_003755, 11 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8676
Clone Number 4F9
Iso type IgG2a Kappa

Enviar un mensaje


STX11 monoclonal antibody (M01), clone 4F9

STX11 monoclonal antibody (M01), clone 4F9