EIF3S3 polyclonal antibody (A01)
  • EIF3S3 polyclonal antibody (A01)

EIF3S3 polyclonal antibody (A01)

Ref: AB-H00008667-A01
EIF3S3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF3S3.
Información adicional
Size 50 uL
Gene Name EIF3H
Gene Alias EIF3S3|MGC102958|eIF3-gamma|eIF3-p40
Gene Description eukaryotic translation initiation factor 3, subunit H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF3S3 (NP_003747, 152 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8667

Enviar un mensaje


EIF3S3 polyclonal antibody (A01)

EIF3S3 polyclonal antibody (A01)