EIF3F purified MaxPab mouse polyclonal antibody (B02P)
  • EIF3F purified MaxPab mouse polyclonal antibody (B02P)

EIF3F purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00008665-B02P
EIF3F purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EIF3F protein.
Información adicional
Size 50 ug
Gene Name EIF3F
Gene Alias EIF3S5|eIF3-p47
Gene Description eukaryotic translation initiation factor 3, subunit F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF3F (NP_003745.1, 1 a.a. ~ 357 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8665

Enviar un mensaje


EIF3F purified MaxPab mouse polyclonal antibody (B02P)

EIF3F purified MaxPab mouse polyclonal antibody (B02P)