EIF3S10 polyclonal antibody (A01)
  • EIF3S10 polyclonal antibody (A01)

EIF3S10 polyclonal antibody (A01)

Ref: AB-H00008661-A01
EIF3S10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF3S10.
Información adicional
Size 50 uL
Gene Name EIF3A
Gene Alias EIF3|EIF3S10|KIAA0139|P167|TIF32|eIF3-p170|eIF3-theta|p180|p185
Gene Description eukaryotic translation initiation factor 3, subunit A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF3S10 (NP_003741, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8661

Enviar un mensaje


EIF3S10 polyclonal antibody (A01)

EIF3S10 polyclonal antibody (A01)