NUMB monoclonal antibody (M01), clone 4A7-A6
  • NUMB monoclonal antibody (M01), clone 4A7-A6

NUMB monoclonal antibody (M01), clone 4A7-A6

Ref: AB-H00008650-M01
NUMB monoclonal antibody (M01), clone 4A7-A6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NUMB.
Información adicional
Size 100 ug
Gene Name NUMB
Gene Alias S171
Gene Description numb homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUMB (AAH33824, 1 a.a. ~ 135 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8650
Clone Number 4A7-A6
Iso type IgG1 kappa

Enviar un mensaje


NUMB monoclonal antibody (M01), clone 4A7-A6

NUMB monoclonal antibody (M01), clone 4A7-A6