NUMB polyclonal antibody (A01)
  • NUMB polyclonal antibody (A01)

NUMB polyclonal antibody (A01)

Ref: AB-H00008650-A01
NUMB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant NUMB.
Información adicional
Size 50 uL
Gene Name NUMB
Gene Alias S171
Gene Description numb homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUMB (AAH33824, 1 a.a. ~ 135 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8650

Enviar un mensaje


NUMB polyclonal antibody (A01)

NUMB polyclonal antibody (A01)