MAPKSP1 monoclonal antibody (M03), clone 2A4
  • MAPKSP1 monoclonal antibody (M03), clone 2A4

MAPKSP1 monoclonal antibody (M03), clone 2A4

Ref: AB-H00008649-M03
MAPKSP1 monoclonal antibody (M03), clone 2A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPKSP1.
Información adicional
Size 100 ug
Gene Name MAPKSP1
Gene Alias MAP2K1IP1|MAPBP|MP1
Gene Description MAPK scaffold protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPKSP1 (NP_068805, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8649
Clone Number 2A4
Iso type IgG1 Kappa

Enviar un mensaje


MAPKSP1 monoclonal antibody (M03), clone 2A4

MAPKSP1 monoclonal antibody (M03), clone 2A4