RNASET2 purified MaxPab mouse polyclonal antibody (B01P)
  • RNASET2 purified MaxPab mouse polyclonal antibody (B01P)

RNASET2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008635-B01P
RNASET2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RNASET2 protein.
Información adicional
Size 50 ug
Gene Name RNASET2
Gene Alias RNASE6PL|bA514O12.3
Gene Description ribonuclease T2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNASET2 (NP_003721.2, 1 a.a. ~ 256 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8635

Enviar un mensaje


RNASET2 purified MaxPab mouse polyclonal antibody (B01P)

RNASET2 purified MaxPab mouse polyclonal antibody (B01P)