CDC2L5 monoclonal antibody (M02), clone 3G1
  • CDC2L5 monoclonal antibody (M02), clone 3G1

CDC2L5 monoclonal antibody (M02), clone 3G1

Ref: AB-H00008621-M02
CDC2L5 monoclonal antibody (M02), clone 3G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC2L5.
Información adicional
Size 100 ug
Gene Name CDC2L5
Gene Alias CDC2L|CHED|FLJ35215|KIAA1791
Gene Description cell division cycle 2-like 5 (cholinesterase-related cell division controller)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC2L5 (AAH01274, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8621
Clone Number 3G1
Iso type IgG2a kappa

Enviar un mensaje


CDC2L5 monoclonal antibody (M02), clone 3G1

CDC2L5 monoclonal antibody (M02), clone 3G1