PPAP2A purified MaxPab mouse polyclonal antibody (B01P)
  • PPAP2A purified MaxPab mouse polyclonal antibody (B01P)

PPAP2A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008611-B01P
PPAP2A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPAP2A protein.
Información adicional
Size 50 ug
Gene Name PPAP2A
Gene Alias LLP1a|LPP1|PAP-2a|PAP2|PAP2a2|PAP2alpha2|PAPalpha1
Gene Description phosphatidic acid phosphatase type 2A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPAP2A (NP_003702.2, 1 a.a. ~ 284 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8611

Enviar un mensaje


PPAP2A purified MaxPab mouse polyclonal antibody (B01P)

PPAP2A purified MaxPab mouse polyclonal antibody (B01P)