KLF7 monoclonal antibody (M01), clone 3E8-B8
  • KLF7 monoclonal antibody (M01), clone 3E8-B8

KLF7 monoclonal antibody (M01), clone 3E8-B8

Ref: AB-H00008609-M01
KLF7 monoclonal antibody (M01), clone 3E8-B8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant KLF7.
Información adicional
Size 100 ug
Gene Name KLF7
Gene Alias UKLF
Gene Description Kruppel-like factor 7 (ubiquitous)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVRSLISAHGRDVSGVLHEAMSSRGTTGNTQVQSPSNATTATGVFPGLTILPST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF7 (AAH12919, 1 a.a. ~ 230 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8609
Clone Number 3E8-B8
Iso type IgG2b Kappa

Enviar un mensaje


KLF7 monoclonal antibody (M01), clone 3E8-B8

KLF7 monoclonal antibody (M01), clone 3E8-B8