STK16 polyclonal antibody (A02)
  • STK16 polyclonal antibody (A02)

STK16 polyclonal antibody (A02)

Ref: AB-H00008576-A02
STK16 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STK16.
Información adicional
Size 50 uL
Gene Name STK16
Gene Alias FLJ39635|KRCT|MPSK|PKL12|TSF1
Gene Description serine/threonine kinase 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STK16 (NP_001008910, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8576

Enviar un mensaje


STK16 polyclonal antibody (A02)

STK16 polyclonal antibody (A02)