AKR7A2 purified MaxPab mouse polyclonal antibody (B01P)
  • AKR7A2 purified MaxPab mouse polyclonal antibody (B01P)

AKR7A2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008574-B01P
AKR7A2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AKR7A2 protein.
Información adicional
Size 50 ug
Gene Name AKR7A2
Gene Alias AFAR|AFAR1|AFB1-AR1|AKR7
Gene Description aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AKR7A2 (AAH10852.1, 1 a.a. ~ 330 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8574

Enviar un mensaje


AKR7A2 purified MaxPab mouse polyclonal antibody (B01P)

AKR7A2 purified MaxPab mouse polyclonal antibody (B01P)