KHSRP monoclonal antibody (M09), clone 4H7
  • KHSRP monoclonal antibody (M09), clone 4H7

KHSRP monoclonal antibody (M09), clone 4H7

Ref: AB-H00008570-M09
KHSRP monoclonal antibody (M09), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KHSRP.
Información adicional
Size 100 ug
Gene Name KHSRP
Gene Alias FBP2|FUBP2|KSRP|MGC99676
Gene Description KH-type splicing regulatory protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KHSRP (NP_003676, 151 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8570
Clone Number 4H7
Iso type IgG2a Kappa

Enviar un mensaje


KHSRP monoclonal antibody (M09), clone 4H7

KHSRP monoclonal antibody (M09), clone 4H7