PDXK purified MaxPab rabbit polyclonal antibody (D01P)
  • PDXK purified MaxPab rabbit polyclonal antibody (D01P)

PDXK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008566-D01P
PDXK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDXK protein.
Información adicional
Size 100 ug
Gene Name PDXK
Gene Alias C21orf124|C21orf97|DKFZp566A071|FLJ31940|FLJ37311|MGC15873|MGC31754|MGC52346|PKH|PNK|PRED79
Gene Description pyridoxal (pyridoxine, vitamin B6) kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDXK (NP_003672.1, 1 a.a. ~ 312 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8566

Enviar un mensaje


PDXK purified MaxPab rabbit polyclonal antibody (D01P)

PDXK purified MaxPab rabbit polyclonal antibody (D01P)