DEGS1 monoclonal antibody (M04), clone 2E9
  • DEGS1 monoclonal antibody (M04), clone 2E9

DEGS1 monoclonal antibody (M04), clone 2E9

Ref: AB-H00008560-M04
DEGS1 monoclonal antibody (M04), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DEGS1.
Información adicional
Size 100 ug
Gene Name DEGS1
Gene Alias DEGS|DES1|Des-1|FADS7|MGC5079|MIG15|MLD
Gene Description degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq SGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DEGS1 (NP_003667, 226 a.a. ~ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8560
Clone Number 2E9
Iso type IgG2b Kappa

Enviar un mensaje


DEGS1 monoclonal antibody (M04), clone 2E9

DEGS1 monoclonal antibody (M04), clone 2E9