CDC14A monoclonal antibody (M01), clone 2C12
  • CDC14A monoclonal antibody (M01), clone 2C12

CDC14A monoclonal antibody (M01), clone 2C12

Ref: AB-H00008556-M01
CDC14A monoclonal antibody (M01), clone 2C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC14A.
Información adicional
Size 100 ug
Gene Name CDC14A
Gene Alias cdc14|hCDC14
Gene Description CDC14 cell division cycle 14 homolog A (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC14A (NP_003663, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8556
Clone Number 2C12
Iso type IgG2b Kappa

Enviar un mensaje


CDC14A monoclonal antibody (M01), clone 2C12

CDC14A monoclonal antibody (M01), clone 2C12