CDC14B purified MaxPab rabbit polyclonal antibody (D01P)
  • CDC14B purified MaxPab rabbit polyclonal antibody (D01P)

CDC14B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008555-D01P
CDC14B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC14B protein.
Información adicional
Size 100 ug
Gene Name CDC14B
Gene Alias CDC14B3|Cdc14B1|Cdc14B2|hCDC14B
Gene Description CDC14 cell division cycle 14 homolog B (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC14B (ENSP00000265659, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8555

Enviar un mensaje


CDC14B purified MaxPab rabbit polyclonal antibody (D01P)

CDC14B purified MaxPab rabbit polyclonal antibody (D01P)