PIAS1 purified MaxPab mouse polyclonal antibody (B01P)
  • PIAS1 purified MaxPab mouse polyclonal antibody (B01P)

PIAS1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008554-B01P
PIAS1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PIAS1 protein.
Información adicional
Size 50 ug
Gene Name PIAS1
Gene Alias DDXBP1|GBP|GU/RH-II|MGC141878|MGC141879|ZMIZ3
Gene Description protein inhibitor of activated STAT, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PIAS1 (NP_057250.1, 1 a.a. ~ 651 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8554

Enviar un mensaje


PIAS1 purified MaxPab mouse polyclonal antibody (B01P)

PIAS1 purified MaxPab mouse polyclonal antibody (B01P)