MAPKAPK5 MaxPab rabbit polyclonal antibody (D01)
  • MAPKAPK5 MaxPab rabbit polyclonal antibody (D01)

MAPKAPK5 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008550-D01
MAPKAPK5 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MAPKAPK5 protein.
Información adicional
Size 100 uL
Gene Name MAPKAPK5
Gene Alias PRAK
Gene Description mitogen-activated protein kinase-activated protein kinase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAPKAPK5 (NP_003659.2, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8550

Enviar un mensaje


MAPKAPK5 MaxPab rabbit polyclonal antibody (D01)

MAPKAPK5 MaxPab rabbit polyclonal antibody (D01)