FCN3 monoclonal antibody (M01A), clone 4B4
  • FCN3 monoclonal antibody (M01A), clone 4B4

FCN3 monoclonal antibody (M01A), clone 4B4

Ref: AB-H00008547-M01A
FCN3 monoclonal antibody (M01A), clone 4B4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant FCN3.
Información adicional
Size 200 uL
Gene Name FCN3
Gene Alias FCNH|HAKA1|MGC22543
Gene Description ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FCN3 (AAH20731, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 8547
Clone Number 4B4
Iso type IgM Kappa

Enviar un mensaje


FCN3 monoclonal antibody (M01A), clone 4B4

FCN3 monoclonal antibody (M01A), clone 4B4