FCN3 MaxPab mouse polyclonal antibody (B01P)
  • FCN3 MaxPab mouse polyclonal antibody (B01P)

FCN3 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008547-B01P
FCN3 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FCN3 protein.
Información adicional
Size 50 ug
Gene Name FCN3
Gene Alias FCNH|HAKA1|MGC22543
Gene Description ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FCN3 (AAH20731.1, 1 a.a. ~ 288 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8547

Enviar un mensaje


FCN3 MaxPab mouse polyclonal antibody (B01P)

FCN3 MaxPab mouse polyclonal antibody (B01P)