PPFIA3 polyclonal antibody (A01)
  • PPFIA3 polyclonal antibody (A01)

PPFIA3 polyclonal antibody (A01)

Ref: AB-H00008541-A01
PPFIA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPFIA3.
Información adicional
Size 50 uL
Gene Name PPFIA3
Gene Alias KIAA0654|LPNA3|MGC126567|MGC126569
Gene Description protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPFIA3 (NP_003651, 1043 a.a. ~ 1139 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8541

Enviar un mensaje


PPFIA3 polyclonal antibody (A01)

PPFIA3 polyclonal antibody (A01)