CAMK1 monoclonal antibody (M01), clone 3G1
  • CAMK1 monoclonal antibody (M01), clone 3G1

CAMK1 monoclonal antibody (M01), clone 3G1

Ref: AB-H00008536-M01
CAMK1 monoclonal antibody (M01), clone 3G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAMK1.
Información adicional
Size 100 ug
Gene Name CAMK1
Gene Alias CAMKI|MGC120317|MGC120318
Gene Description calcium/calmodulin-dependent protein kinase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGTELSPTLPHQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAMK1 (NP_003647, 271 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8536
Clone Number 3G1
Iso type IgG1 Kappa

Enviar un mensaje


CAMK1 monoclonal antibody (M01), clone 3G1

CAMK1 monoclonal antibody (M01), clone 3G1