AB-H00008533-M02
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 50 ug |
Gene Name | COPS3 |
Gene Alias | CSN3|SGN3 |
Gene Description | COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF |
Immunogen Prot. Seq | SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | COPS3 (NP_003644, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 8533 |
Clone Number | 2D10 |
Iso type | IgG2a Kappa |