COPS3 polyclonal antibody (A01)
  • COPS3 polyclonal antibody (A01)

COPS3 polyclonal antibody (A01)

Ref: AB-H00008533-A01
COPS3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COPS3.
Información adicional
Size 50 uL
Gene Name COPS3
Gene Alias CSN3|SGN3
Gene Description COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COPS3 (NP_003644, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8533

Enviar un mensaje


COPS3 polyclonal antibody (A01)

COPS3 polyclonal antibody (A01)