DDO monoclonal antibody (M09), clone 3F7
  • DDO monoclonal antibody (M09), clone 3F7

DDO monoclonal antibody (M09), clone 3F7

Ref: AB-H00008528-M09
DDO monoclonal antibody (M09), clone 3F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DDO.
Información adicional
Size 100 ug
Gene Name DDO
Gene Alias DASOX|DDO-1|DDO-2|FLJ45203
Gene Description D-aspartate oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDO (NP_003640, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8528
Clone Number 3F7
Iso type IgG2a Kappa

Enviar un mensaje


DDO monoclonal antibody (M09), clone 3F7

DDO monoclonal antibody (M09), clone 3F7