DDO polyclonal antibody (A01)
  • DDO polyclonal antibody (A01)

DDO polyclonal antibody (A01)

Ref: AB-H00008528-A01
DDO polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DDO.
Información adicional
Size 50 uL
Gene Name DDO
Gene Alias DASOX|DDO-1|DDO-2|FLJ45203
Gene Description D-aspartate oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDO (NP_003640, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8528

Enviar un mensaje


DDO polyclonal antibody (A01)

DDO polyclonal antibody (A01)