GAS7 monoclonal antibody (M05), clone 1H3
  • GAS7 monoclonal antibody (M05), clone 1H3

GAS7 monoclonal antibody (M05), clone 1H3

Ref: AB-H00008522-M05
GAS7 monoclonal antibody (M05), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GAS7.
Información adicional
Size 100 ug
Gene Name GAS7
Gene Alias KIAA0394|MGC1348|MLL/GAS7
Gene Description growth arrest-specific 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq VEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAS7 (AAH01152.1, 236 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8522
Clone Number 1H3
Iso type IgG1 Kappa

Enviar un mensaje


GAS7 monoclonal antibody (M05), clone 1H3

GAS7 monoclonal antibody (M05), clone 1H3