RANBP3 monoclonal antibody (M01), clone 2E10
  • RANBP3 monoclonal antibody (M01), clone 2E10

RANBP3 monoclonal antibody (M01), clone 2E10

Ref: AB-H00008498-M01
RANBP3 monoclonal antibody (M01), clone 2E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RANBP3.
Información adicional
Size 100 ug
Gene Name RANBP3
Gene Alias DKFZp586I1520
Gene Description RAN binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWLLRHPHPSHPAVGPCLCGEQPALCPCPGLPNYRPGTPAQLGGLLVRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RANBP3 (AAH04349, 298 a.a. ~ 397 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8498
Clone Number 2E10
Iso type IgG2a Kappa

Enviar un mensaje


RANBP3 monoclonal antibody (M01), clone 2E10

RANBP3 monoclonal antibody (M01), clone 2E10