PPFIA4 monoclonal antibody (M10), clone 3B1
  • PPFIA4 monoclonal antibody (M10), clone 3B1

PPFIA4 monoclonal antibody (M10), clone 3B1

Ref: AB-H00008497-M10
PPFIA4 monoclonal antibody (M10), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPFIA4.
Información adicional
Size 100 ug
Gene Name PPFIA4
Gene Alias -
Gene Description protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RQVMEREFNNLLALGTDRKLDDGDDKVFRRAPSWRKRFRPREHHGRGGMLSASAETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPFIA4 (NP_055868, 604 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8497
Clone Number 3B1
Iso type IgG2a Kappa

Enviar un mensaje


PPFIA4 monoclonal antibody (M10), clone 3B1

PPFIA4 monoclonal antibody (M10), clone 3B1