PPFIBP2 monoclonal antibody (M02), clone 3A5
  • PPFIBP2 monoclonal antibody (M02), clone 3A5

PPFIBP2 monoclonal antibody (M02), clone 3A5

Ref: AB-H00008495-M02
PPFIBP2 monoclonal antibody (M02), clone 3A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPFIBP2.
Información adicional
Size 100 ug
Gene Name PPFIBP2
Gene Alias Cclp1|DKFZp781K06126|MGC42541
Gene Description PTPRF interacting protein, binding protein 2 (liprin beta 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPFIBP2 (NP_003612, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8495
Clone Number 3A5
Iso type IgG1 Kappa

Enviar un mensaje


PPFIBP2 monoclonal antibody (M02), clone 3A5

PPFIBP2 monoclonal antibody (M02), clone 3A5